Buy LL37 5MG – Premium Research Peptide Australia

$119.00

Buy LL37 5MG – Premium Research Peptide Australia Choose: LL37 5mg (x1 LL37 5mg vial) or LL37 5MG Starter Kit  Everything you need to get started straight away! (x1 LL37 5MG vial, x1 Bac water, x10 insulin 30g syringes,  x10 alcohol wipes) KEY HIGHLIGHTS Purity: >99% (HPLC Tested) Form: Lyophilised Powder Packaging: Sterile 2ml Vial Intended Use: For laboratory research use only. Not for human consumption. Storage: Store below 25°C, away from light and moisture. PRODUCT OVERVIEW LL-37 is the only known human cathelicidin peptide and is widely studied for its broad-spectrum antimicrobial and immunomodulatory activity. In research environments, LL-37 plays a significant role in innate…

Category:

Description

Buy LL37 5MG – Premium Research Peptide Australia

Choose:

LL37 5mg (x1 LL37 5mg vial)

or

LL37 5MG Starter Kit 

Everything you need to get started straight away!

(x1 LL37 5MG vial, x1 Bac water, x10 insulin 30g syringes,  x10 alcohol wipes)

KEY HIGHLIGHTS

  • Purity: >99% (HPLC Tested)

  • Form: Lyophilised Powder

  • Packaging: Sterile 2ml Vial

  • Intended Use: For laboratory research use only. Not for human consumption.

  • Storage: Store below 25°C, away from light and moisture.


PRODUCT OVERVIEW

LL-37 is the only known human cathelicidin peptide and is widely studied for its broad-spectrum antimicrobial and immunomodulatory activity. In research environments, LL-37 plays a significant role in innate immune response modelling, making it a popular compound for investigations into inflammation, wound biology, and cellular defence mechanisms.

Due to its multifunctional nature, LL-37 is used across a wide range of experimental models — particularly those involving tissue regeneration, microbial interaction, and immune signalling pathways.


POTENTIAL APPLICATIONS (RESEARCH ONLY)

In controlled laboratory settings, LL-37 is commonly researched for:

  • Antimicrobial activity across bacteria, fungi, and biofilm models

  • Innate immune function modelling

  • Inflammation and cytokine response studies

  • Tissue repair and wound biology mechanisms

  • Cellular defence signalling pathways

  • Skin and epithelial barrier research

Note: This compound is strictly for laboratory research. No therapeutic or medical claims are implied.


STORAGE & HANDLING

  • Store below 25°C in a dry, dark environment.

  • Keep vial sealed until use.

  • Reconstituted solutions should be handled aseptically.

  • Avoid repeated freeze–thaw cycles.


SOLUBILITY & STABILITY

LL-37 dissolves in sterile bacteriostatic water under laboratory conditions.
The peptide is sensitive to oxidation and prolonged exposure to room temperature; store reconstituted solutions appropriately to maintain stability.


TRUST & LEGITIMACY

  • COA Included: Certificate of Analysis available for each batch.

  • Lab Verified: Tested via HPLC and Mass Spectrometry.

  • Compliance: Manufactured and sold strictly for scientific, research-only use.


DISCLAIMER

This product is intended for laboratory research use only. Not for human consumption, medical use, veterinary applications, or household purposes. The purchaser assumes all responsibility for proper handling.


ATTRIBUTES

Attribute Detail
CAS Number 259061-43-9
Purity >99% (HPLC)
Appearance White Lyophilised Powder
Molecular Formula C₅₂₀H₉₇₂N₁₇₂O₁₆₇
Molecular Weight ~4493.3 g/mol
Sequence [LL-37, 37 aa]
Form Lyophilised Powder
Packaging Sterile 2ml Vial

Reviews

There are no reviews yet.

Be the first to review “Buy LL37 5MG – Premium Research Peptide Australia”

Your email address will not be published. Required fields are marked *